Free press releases distribution network?

Agency / Source: AnaSpec, Inc.

Check Ads Availability|e-mail Article


Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!



AnaSpec Announces Thirteen New Catalog Peptides - Today AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced thirteen (13) new catalog peptides
AnaSpec Announces Thirteen New Catalog Peptides

 

PRZOOM - /newswire/ - San Jose, CA, United States, 2007/11/09 - Today AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced thirteen (13) new catalog peptides.

   
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Today AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced thirteen (13) new catalog peptides.

Bak BH3 (71-89)- Cat# 62261
This peptide is amino acids 71 to 89 fragment of the Bak BH3 domain. The BH3 domain plays a critical role in mediating the cell death and protein-binding functions of Bak. It is a pro-apoptotic protein. Bak BH3 peptides trigger the rapid activation of caspases. Pharmacological inhibition of caspases prevents BH3-induced apoptosis.
Sequence: MGQVGRQLAIIGDDINRRY

Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide- Cat# 62262
This is a fusion peptide containing amino acids 71 to 89 fragment of the Bak BH3 domain fused to antennapedia peptide. The Bcl-2 homology 3 (BH3) domain is crucial for the death-inducing and dimerization properties of pro-apoptotic members of the Bcl-2 protein family; including Bak; Bax; and Bad. Synthetic peptides corresponding to the BH3 domain of Bak bind to Bcl-xL; antagonize its anti-apoptotic function; and rapidly induce apoptosis when delivered into intact cells via fusion to the antennapedia homeoprotein internalization domain.
Sequence: RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY

Bim BH3 Fragment I; TAMRA labeled- Cat# 62264
This peptide belongs to the Bim family; a subgroup of pro-apoptotic proteins that resemble other Bcl-2 family members within the short BH3 domain only. Pro-apoptotic Bcl-2 activates cell death by neutralizing the anti-apoptotic proteins; which in turn maintain cell viability by regulating the activation of caspases. This peptide is labeled with TAMRA at the N-terminus.
Sequence: 5-TAMRA-DNRPEIWIAQELRRIGDEFNAYYAR

Bim BH3; Fragment II; TAMRA labeled- Cat# 62265
This synthetic peptide is derived from the BH3 domain of Bim that reportedly functions as direct 'death agonist' of Bax. Bim belongs to a distinct subgroup of proapoptotic proteins that resemble other Bcl-2 family members within this BH3 domain. This peptide is labeled with 5-TAMRA at the N-terminus.
Sequence: 5-TAMRA-MRPEIWIAQELRRIGDEFNA

BAK-BH3 (69-93)- Cat# 62272
This peptide belongs to the functional domain of BAK; the member of the Bcl-2 family. Bak promotes apoptosis and binds anti-apoptotic family members including Bcl-2 and Bcl-xL. This domain in Bakt is necessary and sufficient for cytotoxic activity and binding to Bcl-xL. It is capable of modulating apoptosis in cells.
Sequence: STMGQVGRQLAIIGDDINRRYDSEF

Bcl-2 BH3 Peptide II- Cat# 62273
This synthetic peptide is derived from the BH3 domain; member of the Bcl-2 family.
Sequence: LSPVPPVVHLALRQAGDDFSRRYRG

Bcl9-2; mutant- Cat# 62275
This peptide is a mutant form of the Bcl9-2 peptide with the single substitution of Leu to Phe. Beta-catenin-binding wild type protein BCL9-2 is a homolog of the human proto-oncogene product BCL9.
Sequence: GSEGLSKEQLEHRERSFQTLRDIERLLLRSGETEPFLKGPPGGAG-NH2

Bid BH3 (77-100); mouse- Cat# 62317
This peptide is amino acids 77 to 100 fragment of the murine Bid BH3. The BH3 domain of Bid is believed to play an essential role in Bax activation.
Sequence: ESQEEIIHNIARHLAQIGDEMDHN

Bid BH3; Peptide II; TAMRA labeled- Cat# 62277
This sequence belongs to the Bid peptide; a pro-apoptotic member of the 'BH3-only' subset of the BCL-2 family of proteins; the essential regulators of apoptosis. This peptide is labeled with TAMRA.
Sequence: 5-TAMRA-EDIIRNIARHLAQVGDSMDR

Bim BH3; Peptide IV- Cat# 62279
This Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
Sequence: DMRPEIWIAQELRRIGDEFNAYYARR

Bim BH3; Peptide III- Cat# 62278
This Bim peptide belongs to the pro-apoptotic Bcl-2 family of proteins.
Sequence: DMRPEIWIAQELRRIGDEFNAYYAR

Bax I- Cat# 62268
This pro-apoptotic peptide belongs to the Bax group of the Bcl-2 family; the key regulators of apoptosis.
Sequence: PQDASTKKLSECLKRIGDELDSNMEL

a2b1 Integrin Ligand Peptide- Cat# 60909-25
Sequence: DEGA

About AnaSpec, Inc.
AnaSpec, Inc. (anaspec.com) is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.

 
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Agency / Source: AnaSpec, Inc.

 
 

Availability: All Regions (Including Int'l)

 

Traffic Booster: [/] Quick PRZOOM - Press & Newswire Visibility Checker

 

Distribution / Indexing: [+]

 
 
# # #
 

 
  Your Banner Ad showing on ALL
Pharma/BioTech/Nutrition articles,
CATCH Visitors via Your Competitors Announcements!


AnaSpec Announces Thirteen New Catalog Peptides

Company website links NOT available to basic submissions
It is OK to republish and/or LINK any newswire for any legitimate media purpose as long as you name PRZOOM - Press & Newswire and LINK as the source.
 
  For more information, please visit:
Is this your article? Activate ALL web links by Upgrading to Press Release PREMIUM Plan Now!
|
Contact: Ping Yang 
1-408-452-5055 ping[.]anaspec.com
 
PRZOOM / PRTODAY - Newswire Today disclaims any content contained in this article. If you need/wish to contact the company who published the current release, you will need to contact them - NOT us. Issuers of articles are solely responsible for the accuracy of their content. Our complete disclaimer appears here.
IMPORTANT INFORMATION: Issuance, publication or distribution of this press release in certain jurisdictions could be subject to restrictions. The recipient of this press release is responsible for using this press release and the information herein in accordance with the applicable rules and regulations in the particular jurisdiction. This press release does not constitute an offer or an offering to acquire or subscribe for any AnaSpec, Inc. securities in any jurisdiction including any other companies listed or named in this release.

Pharma/BioTech/Nutrition via RSSAdd NewswireToday - PRZOOM Headline News to FeedBurner
Find who RetweetFollow @NewswireTODAY



Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!




Read Latest Press Releases From AnaSpec, Inc. / Company Profile


Read Pharma/BioTech/Nutrition Most Recent Related Press Releases:

Frost & Sullivan Commends Nemaura for Developing Superior Transdermal Drug Delivery Technology Platforms, the Memspatch and Micropatch
Greenphire Sponsors Second Annual Clinical Trial Agreements, Investigator Payments and Fair Market Value Meeting
Genentech’s Gazyva Helped People with Previously Untreated Follicular Lymphoma Live Significantly Longer
BD Announces Adoption of Windows 10 ‘Internet of Things’ for the Pyxis™ ES System
Greenphire Named to Deloitte 2016 Technology Fast 500™
Genentech Showcases New Clinical Data Across a Variety of Blood Diseases at American Society of Hematology 2016 Annual Meeting
BD Collaborates with JDRF to Focus on Extended Wear Innovations for Insulin Infusion Delivery
BD Launches First Syringe Designed for Use with Humulin® R U-500 Insulin
MDxHealth Announces Unique CPT Code Awarded for ConfirmMDx from the American Medical Association
BD MAX™ Vaginal Panel Receives FDA Market Authorization to Detect Most Common Causes of Vaginal Infections

Boost Your Social Network
& Crowdfunding Campaigns


LIFETIME SOCIAL MEDIA WALL
 
NewswireToday Celebrates 10 Years in Business
Find business coaching, life coaching, executive coaching and corporate coaching, best selling coaching books, ...



PREMIUM Members


Visit  BizJobs.com

Visit  Triggr & Bloom

Visit  La Bella Bakery Artisan Bakery Arizona







 
  ©2016 PRZOOM — Limelon Advertising, Co.
Home | About PRZOOM | Advertise/Pricing | Contact | Investors | Privacy/TOS | Sitemap | FRANCAIS
newswire, PR free press releases distribution service magazines engine news alert newsroom press room breaking news public relations articles company news alerts newswiredistribution ezine bizentrepreneur biznewstoday digital business report market search pr firms agencies reports distri-bution today investor relation successful internet entrepreneur newswire distribution prtoday.com freenewswiredistribution asianewstoday bizwiretoday USA pr UK today