Free press releases distribution network?

Agency / Source: AnaSpec, Inc.

Check Ads Availability|e-mail Article


Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!



AnaSpec Introduces Nine New Catalog Peptides - AnaSpec introduced nine (9) new peptides for drug discovery research
AnaSpec Introduces Nine New Catalog Peptides

 

PRZOOM - /newswire/ - San Jose, CA, United States, 2007/09/24 - AnaSpec introduced nine (9) new peptides for drug discovery research.

   
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Today AnaSpec, one of the world’s largest providers of custom and catalog peptides, introduced nine (9) new peptides for drug discovery research.

Rat Renin FRET Substrate (5-FAM/QXL™520) - Cat# 62334
This renin FRET peptide is a specific substrate for rat renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by rat renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. The SensoLyte™ 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.

Peptide Substrate for Renin 520 Assay kit - Cat# 61872-01
This FRET peptide is a specific substrate for renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte™ 520 Renin Assay Kit; cat # 72040.

Rat Renin FRET Substrate (5-FAM/QXL™520) - Cat# 62334-01
This renin FRET peptide is a specific substrate for rat renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by rat renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. The SensoLyte™ 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.

[Glu1]-Fibrinopeptide B - Cat# 60501-1
Sequence: EGVNDNEEGFFSAR

Cyclo[-RGDyK(HiLyte Fluor™ 750)-] - Cat# 62333-1
Sequence: Cyclo[-RGDy-K(Hilyte Fluor 750)-]

Cyclo[-RGDyK(HiLyte Fluor™ 750)-] - Cat# 62333-01
Sequence: Cyclo[-RGDy-K(Hilyte Fluor 750)-]

Beta-Amyloid (1-42); Scrambled; 5-FAM labeled - Cat# 60892
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA

BPE-Conjugated-beta-Amyloid(1-40) - Cat# 60496
Sequence: B-Phycoerythrin-Conjugated-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

MAPS; Core; 8-Branch - Cat# 21006
Sequence: K4K2KA-NH2

About AnaSpec, Inc.
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.

 
 
Your Banner Ad Here instead - Showing along with ALL Articles covering Pharma/BioTech/Nutrition Announcements

Replace these Affiliate Programs at ANYTIME! Your banner here within the next hour. Learn How!


 

Agency / Source: AnaSpec, Inc.

 
 

Availability: All Regions (Including Int'l)

 

Traffic Booster: [/] Quick PRZOOM - Press & Newswire Visibility Checker

 

Distribution / Indexing: [+]

 
 
# # #
 

 
  Your Banner Ad showing on ALL
Pharma/BioTech/Nutrition articles,
CATCH Visitors via Your Competitors Announcements!


AnaSpec Introduces Nine New Catalog Peptides

Company website links NOT available to basic submissions
It is OK to republish and/or LINK any newswire for any legitimate media purpose as long as you name PRZOOM - Press & Newswire and LINK as the source.
 
  For more information, please visit:
Is this your article? Activate ALL web links by Upgrading to Press Release PREMIUM Plan Now!
|
Contact: Ping Yang 
1-408-452-5055 ping[.]anaspec.com
 
PRZOOM / PRTODAY - Newswire Today disclaims any content contained in this article. If you need/wish to contact the company who published the current release, you will need to contact them - NOT us. Issuers of articles are solely responsible for the accuracy of their content. Our complete disclaimer appears here.
IMPORTANT INFORMATION: Issuance, publication or distribution of this press release in certain jurisdictions could be subject to restrictions. The recipient of this press release is responsible for using this press release and the information herein in accordance with the applicable rules and regulations in the particular jurisdiction. This press release does not constitute an offer or an offering to acquire or subscribe for any AnaSpec, Inc. securities in any jurisdiction including any other companies listed or named in this release.

Pharma/BioTech/Nutrition via RSSAdd NewswireToday - PRZOOM Headline News to FeedBurner
Find who RetweetFollow @NewswireTODAY



Are you the owner of this article?, Turn it PREMIUM with your LOGO instead - and make it 3rd party Ads-Free! within the next hour!




Read Latest Press Releases From AnaSpec, Inc. / Company Profile


Read Pharma/BioTech/Nutrition Most Recent Related Press Releases:

Greenphire Sponsors Second Annual Clinical Trial Agreements, Investigator Payments and Fair Market Value Meeting
Genentech’s Gazyva Helped People with Previously Untreated Follicular Lymphoma Live Significantly Longer
BD Announces Adoption of Windows 10 ‘Internet of Things’ for the Pyxis™ ES System
Greenphire Named to Deloitte 2016 Technology Fast 500™
Genentech Showcases New Clinical Data Across a Variety of Blood Diseases at American Society of Hematology 2016 Annual Meeting
BD Collaborates with JDRF to Focus on Extended Wear Innovations for Insulin Infusion Delivery
BD Launches First Syringe Designed for Use with Humulin® R U-500 Insulin
MDxHealth Announces Unique CPT Code Awarded for ConfirmMDx from the American Medical Association
BD MAX™ Vaginal Panel Receives FDA Market Authorization to Detect Most Common Causes of Vaginal Infections
Greenphire Receives EU-US Privacy Shield Certification

Boost Your Social Network
& Crowdfunding Campaigns


LIFETIME SOCIAL MEDIA WALL
 
NewswireToday Celebrates 10 Years in Business
Find business coaching, life coaching, executive coaching and corporate coaching, best selling coaching books, ...



PREMIUM Members


Visit  Triggr & Bloom

Visit  JobsWare.com

Visit  La Bella Bakery Artisan Bakery Arizona







 
  ©2016 PRZOOM — Limelon Advertising, Co.
Home | About PRZOOM | Advertise/Pricing | Contact | Investors | Privacy/TOS | Sitemap | FRANCAIS
newswire, PR free press releases distribution service magazines engine news alert newsroom press room breaking news public relations articles company news alerts newswiredistribution ezine bizentrepreneur biznewstoday digital business report market search pr firms agencies reports distri-bution today investor relation successful internet entrepreneur newswire distribution prtoday.com freenewswiredistribution asianewstoday bizwiretoday USA pr UK today